БИОХИМИЯ, 2021, том 86, вып. 4, с. 584–594

УДК 615+616-05

Антиоксидантные свойства галанина и его N-концевых фрагментов при моделировании окислительного стресса in vitro и in vivо*

© 2021 О.И. Писаренко **, И.М. Студнева, Л.И. Серебрякова, А.А. Тимошин, Г.Г. Коновалова, В.З. Ланкин, А.К. Тихазе, О.М. Веселова, И.В. Доброхотов, Р.О. Любимов, М.В. Сидорова, М.Е. Палькеева, А.С. Молокоедов

ФГБУ «НМИЦ кардиологии» Минздрава РФ, 121552 Москва, Россия; электронная почта: olpi@live.ru

Поступила в редакцию 21.12.2020
После доработки 04.02.2021
Принята к публикации 08.02.2021

DOI: 10.31857/S0320972521040102

КЛЮЧЕВЫЕ СЛОВА: галанин, сердце, ишемия и реперфузия, некроз, перекисное окисление липидов, антиоксидантные ферменты, мембраны кардиомиоцитов.

Аннотация

Антиоксидантные свойства галанина крысы GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 (Gal), N-концевого фрагмента галанина (2–15 а. о.) WTLNSAGYLLGPHA (G1) и его модифицированного аналога WTLNSAGYLLGPβAH (G2) изучены на моделях региональной ишемии и реперфузии сердца крысы in vivo и Сu2+-индуцированного свободнорадикального окисления липопротеидов низкой плотности в плазме человека in vitro. Пептиды получены автоматическим твердофазным синтезом с использованием Fmoc-методологии. Их структура охарактеризована с помощью 1Н-ЯМР-спектроскопии и MALDI-TOF масс-спектрометрии. Полученные данные о влиянии пептидов показали, что внутривенное введение G1, G2 и Gal крысам после индуцированной ишемии уменьшало размеры инфаркта миокарда и активность маркеров некроза, креатинкиназы-МВ и лактатдегидрогеназы, в плазме крови к концу реперфузии. G1, G2 и Gal снижали образование спинового аддукта гидроксильных радикалов в интерстиции зоны риска сердца при реперфузии; более того, G2 и Gal также снижали образование вторичных продуктов перекисного окисления липидов в реперфузированном миокарде. В экспериментах in vivo и in vitro показано, что способность пептидов галанина снижать продукцию АФК и ингибировать перекисное окисление липидов при реперфузионном повреждении миокарда не связана напрямую с их влиянием на активность ферментов антиоксидантной защиты – Сu,Zn-супероксиддисмутазы, каталазы и глутатионпероксидазы. Пептиды G1, G2 и Gal в концентрации 0,01 и 0,1 мМ ингибировали Сu2+-индуцированное свободнорадикальное окисление липопротеидов низкой плотности человека in vitro. Полученные при моделировании окислительного стресса результаты показывают, что природные и синтетические агонисты рецепторов галанина снижают продукцию короткоживущих АФК в сердце, а также липидных радикалов в плазме крови. Таким образом, рецепторы галанина могут быть перспективной терапевтической мишенью при сердечно-сосудистых заболеваниях.

Сноски

* Первоначально английский вариант рукописи опубликован на сайте «Biochemistry» (Moscow) http://protein.bio.msu.ru/biokhimiya, в рубрике «Papers in Press», BM20-393, 25.03.2021.

** Адресат для корреспонденции.

Финансирование

Работа выполнена при финансовой поддержке Российского фонда фундаментальных исследований (гранты № 18-015-0008-а и 18-015-0009-а).

Конфликт интересов

Авторы заявляют об отсутствии конфликта интересов.

Соблюдение этических норм

Все применимые международные, национальные и/или институциональные принципы ухода за лабораторными животными и их использования в экспериментах были соблюдены.

Список литературы

1. Branchek, T. A., Smith, K. E., Gerald, C., and Walker, M. W. (2000) Galanin receptor subtypes, Trends Pharmacol. Sci., 21, 109-117, doi: 10.1016/S0165-6147(00)01446-2.

2. Timotin, A., Pisarenko, O., Sidorova, M., Studneva, I., Shulzhenko, V., et al. (2017) Myocardial protection from ischemia/reperfusion injury by exogenous galanin fragment, Oncotarget, 8, 21241-21252, doi: 10.18632/oncotarget.15071.

3. Pisarenko, O., Timotin, A., Sidorova, M., Studneva, I., Shulzhenko, V., et al. (2017) Cardioprotective properties of N-terminal galanin fragment (2-15) in experimental ischemia/reperfusion injury, Oncotarget, 8, 60, 101659-101671, doi: 10.18632/oncotarget.21503.

4. Азьмуко А. А., Веселова О. М., Молокоедов А. С., Овчинников М. В., Палькеева М. Е., Писаренко О. И., Серебрякова Л. И., Сидорова М. В., Студнева И. М. (2018) Тетрадекапептиды, улучшающие восстановительную функцию сердечно-сосудистой системы при ишемии. Патент № 2648846. РФ. A61K 38/10 (2006.01).

5. Palkeeva, M., Studneva, I., Molokoedov, A., Serebryakova, L., Veselova, O., et al. (2019) Galanin/GalR1-3 system: a promising therapeutic target for myocardial ischemia/reperfusion injury, Biomed. Pharmacother., 109, 1556-1562, doi: 10.1016/j.biopha.2018.09.182.

6. Студнева И. М., Веселова О. М., Бахтин A. A., Коновалова Г. Г., Ланкин В. З., Писаренко О. И. (2020) Механизмы защиты сердца синтетическим агонистом рецепторов галанина при повреждении хроническим введением доксорубицина, Acta Naturae, 12, 28-37, doi: 10.32607/actanaturae.10945.

7. Sidorova, M. V., Palkeeva, M. E., Avdeev, D. V., Molokoedov, A. S., Ovchinnikov, M. V., et al. (2020) Convergent synthesis of the rat galanin and study of its biological activity, Russ. J. Bioorg. Chem., 46, 32-42, doi: 10.1134/S1068162020010100.

8. Kitakaze, M., Takashima, S., Funaya, H., Minamino, T., Node, K., et al. (1997) Temporary acidosis during reperfusion limits myocardial infarct size in dogs, Am. J. Physiol., 272, H2071-H2078, doi: 10.1152/ajpheart.1997.272.5.H2071.

9. Beauchamp, C., and Fridovich, I. (1971) Superoxide dismutase: improved assays and assay applicable to acrylamide gels, Anal. Biochem., 44, 276-287, doi: 10.1016/0003-2697(71)90370-8.

10. Aebi, H. (1984) Catalase in vitro, Methods Enzymol., 105, 121-126, doi: 10.1016/s0076-6879(84)05016-3.

11. Ланкин В. З., Гуревич С. М. (1976) Ингибирование переокисления липидов и детоксикация липоперекисей защитными ферментативными системами (супероксиддисмутаза, глутатионпероксидаза, глутатионредуктаза) при экпериментальном злокачественном росте, ДАН СССР, 226, 705-708.

12. Draper, H. H., and Hadley, M. (1990) Malondialdehyde determination as index of lipid peroxidation, Methods Enzymol., 186, 421-431, doi: 10.1016/0076-6879(90)86135-i.

13. Ланкин В. З., Кандалинцева Н. В., Коновалова Г. Г., Тихазе А. К., Хольшин С. В., Ягунов С. Е., Одинокова О. А. (2017) Способ экспресс-скрининга потенциальных антиоксидантов с использованием кинетической модели медь-инициированного свободнорадикального окисления липопротеидов низкой плотности плазмы крови человека. Патент на изобретение RU 2629398.

14. Britigan, B. E., Cohen, M. S., and Rosen, G. M. (1987) Detection of the production of oxygen-centered free radicals by human neutrophils using spin trapping techniques: a critical perspective, J. Leukoc. Biol., 41, 349-362, doi: 10.1002/jlb.41.4.349.

15. Vanden Hoek, T. L., Shao, Z., Li, C., Zak, R., Schumacker, P. T., and Becker, L. B. (1996) Reperfusion injury on cardiac myocytes after simulated ischemia, Am. J. Physiol., 270, H1334-H1341, doi: 10.1152/ajpheart.1996.270.4.H1334.

16. Эмануэль Н. М., Лясковская Ю. Н. (1961) Торможение процессов окисления жиров, Пищепромиздат, Москва, стр. 10-19.

17. Lankin, V., Konovalova, G., Tikhaze, A., Shumaev, K., Kumskova, E., and Viigimaa, M. (2014) The initiation of free radical peroxidation of low-density lipoproteins by glucose and its metabolite methylglyoxal: a common molecular mechanism of vascular wall injure in atherosclerosis and diabetes, Mol. Cell. Biochem., 395, 241-252, doi: 10.1007/s11010-014-2131-2.

18. Lankin V. Z. (2003) The enzymatic systems in the regulation of free radical lipid peroxidation, in Free Radicals, Nitric Oxide, and Inflammation: Molecular, Biochemical, and Clinical Aspects, NATO Science Series (Tomasi, A., et al., eds) vol. 344, IOS Press, Amsterdam, pp. 8-23.

19. Lankin, V. Z., Antonovsky, V. L., and Tikhaze, A. K. (2004) Regulation of Free radical lipoperoxidation and organic peroxides metabolism during normal station and pathologies, in Peroxides at the Beginning of the Third Millennium (Antonovsky, V.L., et al., eds) Nova Science Publishers Inc., New York, pp. 85-111.

20. Тимошин А. А., Дроботова Д. Ю., Цкитишвили О. В., Серебрякова Л. И., Писаренко О. И., Рууге Э. К., Ванин А. Ф. (2010) Защитное действие динитрозильных комплексов железа с глутатионом в условиях региональной ишемии миокарда крыс: исследование методом микродиализа, Доклады Академии Наук (Раздел «Биофизика»), 432, 416-419.

21. Murphy, E., and Steenbergen, C. (2008) Mechanisms underlying acute protection from cardiac ischemia-reperfusion injury, Physiol. Rev., 88, 581-609, doi: 10.1152/physrev.00024.2007.

22. Timotin, A., Cinato, M., Kramar, S., Loy, H., Merabishvili, G., and (2019) Galanin is a checkpoint regulator of mitochondrial biogenesis coordinating a pro-survival phenotype in post-infarct myocardial remodeling, Lancet, preprint, doi: 10.2139/ssrn.3424189.

23. Power, O., Jakeman, P., and FitzGerald, R. J. (2013) Antioxidative peptides: enzymatic production, in vitro and in vivo antioxidant activity and potential applications of milk-derived antioxidative peptides, Amino Acids, 44, 797-820, doi: 10.1007/s00726-012-1393-9.

24. Jakubczyk, A., Karas, M., Rybczynska-Tkaczyk, K., Zielinska, E., and Zielinski, D. (2020) Current trends of bioactive peptides – new sources and therapeutic effect, Foods, 9, 846, doi: 10.3390/foods9070846.

25. Tian, R., and Abel, E. D. (2001) Responses of GLUT4-deficient hearts to ischemia underscore the importance of glycolysis, Circulation, 103, 2961-2966, doi: 10.1161/01.CIR.103.24.2961.

26. Lang, R., Gundlach, A. L., Holmes, F. E., Hobson, S. A., Wynick, D., et al. (2015) Physiology, signaling, and pharmacology of galanin peptides and receptors: three decades of emerging diversity, Pharmacol. Rev., 67, 118-175.

27. Krijnen, P. A., Nijmeijer, R., Meijer, C. J., Visser, C. A., Hack, C. E., and Niessen, H. W. (2002) Apoptosis in myocardial ischaemia and infarction, J. Clin. Pathol., 55, 801-811, doi: 10.1136/jcp.55.11.801.

28. Hausenloy, D. J., and Yellon, D. M. (2013) Myocardial ischemia-reperfusion injury: a neglected therapeutic target, J. Clin Invest., 123, 92-100, doi: 10.1172/JCI62874.

29. Jay, M. A., and Ren, J. (2007) Peroxisome proliferator-activated receptor (PPAR) in metabolic syndrome and type 2 diabetes mellitus, Curr. Diab. Rev., 3, 33-39, doi: 10.2174/157339907779802067.